compare

Comparison List

zFP538

a.k.a. zYFP538, zoanYFP

zFP538 is a basic (constitutively fluorescent) yellow fluorescent protein published in 1999, derived from Zoanthus sp..

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Tetramer Zoanthus sp. 26.2 kDa -

FPbase ID: 15MYG

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
528 538 20,200 0.42 8.48      
Edit States/Attributes

Photostability

No photostability measurements available ... add one!

zFP538 Sequence

BLAST
MAHSKHGLKEEMTMKYHMEGCVNGHKFVITGEGIGYPFKGKQTINLCVIEGGPLPFSEDILSAGFKYGDRIFTEYPQDIVDYFKNSCPAGYTWGRSFLFEDGAVCICNVDITVSVKENCIYHKSIFNGMNFPADGPVMKKMTTNWEASCEKIMPVPKQGILKGDVSMYLLLKDGGRYRCQFDTVYKAKSVPSKMPEWHFIQHKLLREDRSDAKNQKWQLTEHAIAFPSALA
GenBank: AAF03373
UniProtKB: Q9U6Y4
IPG: 822426

Structure

Deposited: ,
Chromophore:

Excerpts

No excerpts have been added for zFP538
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Erratum: Fluorescent proteins from nonbioluminescent Anthozoa species

Matz Mv, Fradkov Af, Labas Ya, Savitsky Ap, Zaraisky Ag, Markelov Ml, Lukyanov Sa

(1999). Nature Biotechnology, 17(10) , 969-973. doi: 10.1038/13657. Article   Pubmed

Additional References

  1. zFP538, a Yellow-Fluorescent Protein fromZoanthus, Contains a Novel Three-Ring Chromophore†,‡

    Remington Sj, Wachter Rm, Yarbrough Dk, Branchaud B, Anderson Dc, Kallio K, Lukyanov Ka

    (2005). Biochemistry, 44(1) , 202-212. doi: 10.1021/bi048383r. Article   Pubmed

  2. Diversity and evolution of the green fluorescent protein family

    Labas Ya, Gurskaya Ng, Yanushevich Yg, Fradkov Af, Lukyanov Ka, Lukyanov Sa, Matz Mv

    (2002). Proceedings of the National Academy of Sciences, 99(7) , 4256-4261. doi: 10.1073/pnas.062552299. Article   Pubmed

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change