compare

Comparison List

Javascript is disabled! Many pages and features of FPbase will not work properly

10B

This protein has unmoderated changes. Click here to view the last moderated version of this protein from Dec 5, 2018 01:53:07. Or view the full change history

10B is a green/yellow fluorescent protein published in 1996, derived from Aequorea victoria.

No spectrum has been submitted ... add a spectrum!

Oligomerization	Organism	Molecular Weight	Cofactor
?	Aequorea victoria	26.9 kDa	-

FPbase ID: RO9XQ

Attributes

Ex λ	Em λ	EC (M^-1 cm^-1)	QY	Brightness	pKa	Maturation (min)	Lifetime (ns)
513	525	30,800

Edit States/Attributes

Photostability

No photostability measurements available ... add one!

10B Sequence

BLAST

10B was derived from avGFP with the following mutations: F64L/S65G/S72A/T203YF64L/S65G/S72A/T203Y

MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLGYGVQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSYQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK

Excerpts

No excerpts have been added for 10B
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Crystal Structure of the Aequorea victoria Green Fluorescent Protein

Orm M, Cubitt Ab, Kallio K, Gross La, Tsien Ry, Remington Sj

(1996). Science, 273(5280) , 1392-1395. doi: 10.1126/science.273.5280.1392. Article

Additional References

No additional references have been added.

External Resources

Search Addgene for 10B
Search RIKEN BRC for 10B

Change history

Something missing or incorrect? Submit a change Submit a change