compare

Comparison List

ZsYellow1

ZsYellow1 is a basic (constitutively fluorescent) yellow fluorescent protein, derived from Zoanthus sp..
+
Oligomerization Organism Molecular Weight Cofactor
Tetramer Zoanthus sp. 26.1 kDa -

FPbase ID: LTFO5

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
529 539 20,000 0.65 13.0      

Photostability

No photostability measurements available ... add one!

ZsYellow1 Sequence

ZsYellow1 was derived from zFP538 with the following mutations: M129V

MAHSKHGLKEEMTMKYHMEGCVNGHKFVITGEGIGYPFKGKQTINLCVIEGGPLPFSEDILSAGFKYGDRIFTEYPQDIVDYFKNSCPAGYTWGRSFLFEDGAVCICNVDITVSVKENCIYHKSIFNGVNFPADGPVMKKMTTNWEASCEKIMPVPKQGILKGDVSMYLLLKDGGRYRCQFDTVYKAKSVPSKMPEWHFIQHKLLREDRSDAKNQKWQLTEHAIAFPSALA

Excerpts

No excerpts have been added for ZsYellow1
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change