compare

Comparison List

zRFP

zRFP is a fluorescent protein published in 2009, derived from Zoanthus sp..

No spectrum has been submitted ... add a spectrum!

Aggregation Organism Molecular Weight Cofactor
? Zoanthus sp. 25.9 kDa -

Attributes

This protein does not yet have any fluorescent states assigned. Submit a change.

Photostability

no photostability measurements available ... add one!

zRFP Sequence

MAHSKHGLTNDMTMKFRMEGCVDGHQFVITGHGNGNPFTGEQTINLCVDKGGPLPFSEDILSAAFDYGNRLFTEYPQGIVDYFKNSCPAGYTWQRSFLFEDGAVCIASADISVKENCIHHYSTFYGVNFPVDGPVMKKVTYNWEPSCEKIIPIPSQEILKGDVSMYLLLKDGGRYRCQFDTIYKAKSKPKVMPDWHFIQHKLTREDRSDAKNQKWQLVEHAVASRSALP
GenBank: ACD03134
UniProtKB: B2ZAG2
IPG: 14915008

Excerpts

No excerpts have been added for zRFP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references yet...

External Resources

Something missing or incorrect? Submit a change Submit a change