compare

Comparison List

zRFP

zRFP is a fluorescent protein published in 2009, derived from Zoanthus sp..

No spectrum has been submitted ... but a protein must have at least one state first. Add a state.

Oligomerization Organism Molecular Weight Cofactor
? Zoanthus sp. 25.9 kDa -

FPbase ID: 4PHX7

Attributes

This protein does not yet have any fluorescent states assigned. Submit a change.

Photostability

No photostability measurements available ... add one!

zRFP Sequence

BLAST
MAHSKHGLTNDMTMKFRMEGCVDGHQFVITGHGNGNPFTGEQTINLCVDKGGPLPFSEDILSAAFDYGNRLFTEYPQGIVDYFKNSCPAGYTWQRSFLFEDGAVCIASADISVKENCIHHYSTFYGVNFPVDGPVMKKVTYNWEPSCEKIIPIPSQEILKGDVSMYLLLKDGGRYRCQFDTIYKAKSKPKVMPDWHFIQHKLTREDRSDAKNQKWQLVEHAVASRSALP
GenBank: ACD03134
UniProtKB: B2ZAG2
IPG: 14915008

Excerpts

No excerpts have been added for zRFP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

DSN Depletion is a Simple Method to Remove Selected Transcripts from cDNA Populations

Bogdanova Ea, Shagina Ia, Mudrik E, Ivanov I, Amon P, Vagner Ll, Lukyanov Sa, Shagin Da

(2009). Molecular Biotechnology, 41(3) , 247-253. doi: 10.1007/s12033-008-9131-y. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change