compare

Comparison List

zGFP

zGFP is a fluorescent protein published in 2009, derived from Zoanthus sp..

No spectrum has been submitted ... but a protein must have at least one state first. Add a state.

Oligomerization Organism Molecular Weight Cofactor
? Zoanthus sp. 26.0 kDa -

FPbase ID: OMXT2

Attributes

This protein does not yet have any fluorescent states assigned. Submit a change.

Photostability

No photostability measurements available ... add one!

zGFP Sequence

MAYSKQGLTDNMTMKYQMEGCVDGHQFVITGHGKGNPFTGKQTLNLCVDKGGPLPFSEDILSAVFTYGNRIFADYPQDIDDYFKNSCPAGYTWTRSFLFEDGAVAIASADIRLSVQEKCFHHVSRFYGVNFPADGPVMKKMTTDWEPSTEKIIPVPSQGILKGDASMYLLLKDGGRYRCQFDSVYKAKSKPKVMPDWHFIQHKLTREDRSDAKNQKWQLVEHASASRSALP
GenBank: ACD03133
UniProtKB: B2ZAG1
IPG: 14915007

Excerpts

No excerpts have been added for zGFP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change