compare

Comparison List

Javascript is disabled! Many pages and features of FPbase will not work properly

Var1

This protein has unmoderated changes.

Var1 is a basic (constitutively fluorescent) green fluorescent protein published in 2025, derived from Aequorea victoria.

⁺

Oligomerization	Organism	Molecular Weight	Cofactor
?	Aequorea victoria	26.9 kDa	-

FPbase ID: 9H4UT

Attributes

Ex λ	Em λ	EC (M^-1 cm^-1)	QY	Brightness	pKa	Maturation (min)	Lifetime (ns)
484	508	62,241	0.8	49.79

Edit States/Attributes

Photostability

No photostability measurements available ... add one!

Var1 Sequence

BLAST

Var1 was derived from avGFP with the following mutations: I47V/Q69K/S72A/V93I/N105Q I47V/Q69K/S72A/V93I/N105Q

MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFVCTTGKLPVPWPTLVTTFSYGVKCFARYPDHMKQHDFFKSAMPEGYIQERTIFFKDDGQYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK

Excerpts

No excerpts have been added for Var1
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Autonomous liquid-handling robotics scripting through large language models enables accessible and safe protein engineering workflows

Gao Y, Luo Y, Lan Y, Jiang H, Fu L, Si T

(2025). , , . doi: 10.1101/2025.09.30.679666. Article

Additional References

No additional references have been added.

External Resources

Search Addgene for Var1
Search RIKEN BRC for Var1

Change history

Something missing or incorrect? Submit a change Submit a change