compare

Comparison List

V127T SAASoti

V127T SAASoti is a photoconvertible red fluorescent protein published in 2018, derived from Stylocoeniella armata.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Monomer Stylocoeniella armata 25.2 kDa -

FPbase ID: 1U9ZJ

Attributes

State Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
Green 509 519 75,000          
Red 579 589 24,000          

Transitions

From To Switch λ
Green Red 405

Photostability

No photostability measurements available ... add one!

V127T SAASoti Sequence

MALSKQYIPDDMELIFHMDGCVNGHYFTIVATGKAKPYEGKQNLKATVTKGAPLPFSTDILSTVMHYGNRCIVHYPPGILDYFKQSFPEGYSWERTFAFEDGGFCTASADIKLKDNCFIHTSMFHGTNFPADGPVMQRKTIQWEKSIEKMTVSDGIVKGDITMFLLLEGGGKYRCQFHTSYKAKKVVEMPQSHYVEHSIERTNDDGTQFELNEHAVARLNEI

Excerpts

No excerpts have been added for V127T SAASoti
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

  1. Novel Phototransformable Fluorescent Protein SAASoti with Unique Photochemical Properties

    Solovyev Id, Gavshina Av, Savitsky Ap

    (2019). International Journal of Molecular Sciences, 20(14) , 3399. doi: 10.3390/ijms20143399. Article   Pubmed

  2. Reversible photobleaching of photoconvertible SAASoti-FP

    Solovyev I, Gavshina A, Savitsky A

    (2017). Journal of Biomedical Photonics & Engineering, 3(4) , 040303. doi: 10.18287/jbpe17.03.040303. Article

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change