compare

Comparison List

TurboYFP

TurboYFP is a basic (constitutively fluorescent) yellow fluorescent protein published in 2021, derived from Phialidium sp. SL-2003. It has moderate acid sensitivity.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Dimer Phialidium sp. SL-2003 26.9 kDa -

FPbase ID: TC87V

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
525 538 105,000 0.53 55.65 5.9    
Edit States/Attributes

Photostability

No photostability measurements available ... add one!

TurboYFP Sequence

BLAST
MSSGALLFHGKIPYVVEMEGNVDGHTFSIRGKGYGDASVGKVDAQFICTTGDVPVPWSTLVTTLTYGAQCFAKYGPELKDFYKSCMPDGYVQERTITFEGDGNFKTRAEVTFENGSVYNRVKLNGQGFKKDGHVLGKNLEFNFTPHCLYIWGDQANHGLKSAFKICHEITGSKGDFIVADHTQMNTPIGGGPVHVPEYHHMSYHVKLSKDVTDHRDNMSLKETVRAVDCRKTYDFDAGSGDTS

Excerpts

No excerpts have been added for TurboYFP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Fluorescent bacterial biosensor E. coli/pTdcR-TurboYFP sensitive to terahertz radiation

Serdyukov Ds, Goryachkovskaya Tn, Mescheryakova Ia, Kuznetsov Sa, Popik Vm, Peltek Se

(2021). Biomedical Optics Express, 12(2) , 705. doi: 10.1364/boe.412074. Article

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change