compare

Comparison List

Trp-less GFP

Trp-less GFP is a fluorescent protein published in 2012, derived from Aequorea victoria.

No spectrum has been submitted ... but a protein must have at least one state first. Add a state.

Oligomerization Organism Molecular Weight Cofactor
? Aequorea victoria 25.6 kDa -

FPbase ID: 9ZKVW

Attributes

This protein does not yet have any fluorescent states assigned. Submit a change.

Photostability

No photostability measurements available ... add one!

Trp-less GFP Sequence

KSKGEELFAGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPFPTLVTTLSYGVQCFSRYPDHMKRHDFFKSAMPEGYVQERTISFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYITADKQKNGIKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHCLSTQTVLSKDPNEKRDHMVLLEFVTAAGI

Structure

Deposited: ,
Chromophore (SYG):

Excerpts

No excerpts have been added for Trp-less GFP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change