compare

Comparison List

TagYFP

TagYFP is a basic (constitutively fluorescent) green/yellow fluorescent protein, derived from Aequorea macrodactyla. It has moderate acid sensitivity.
+
Oligomerization Organism Molecular Weight Cofactor
Monomer Aequorea macrodactyla 27.0 kDa -

FPbase ID: V7M33

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
508 524 50,000 0.62 31.0 5.5    

Photostability

No photostability measurements available ... add one!

TagYFP Sequence

MVSKGEELFAGIVPVLIELDGDVHGHKFSVRGEGEGDADYGKLEIKFICTTGKLPVPWPTLVTTLTYGVQCFARYPKHMKMNDFFKSAMPEGYIQERTILFQDDGKYKTRGEVKFEGDTLVNRIELKGKDFKEDGNILGHKLEYSFNSHNVYITPDKANNGLEVNFKTRHNIEGGGVQLADHYQTNVPLGDGPVLIPINHYLSYQTDISKDRNEARDHMVLLESVSACSHTHGMDELYR

Excerpts

No excerpts have been added for TagYFP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change