compare

Comparison List

sympFP

sympFP is a fluorescent protein published in 2009, derived from Scleractinia sp. Lizard Island 37.

No spectrum has been submitted ... but a protein must have at least one state first. Add a state.

Oligomerization Organism Molecular Weight Cofactor
? Scleractinia sp. Lizard Island 37 kDa -

FPbase ID: O7UJT

Attributes

This protein does not yet have any fluorescent states assigned. Submit a change.

Photostability

No photostability measurements available ... add one!

sympFP Sequence

MSVIKADMKMKLRMVGAVNGHKFEIAGEGKGKPFEGKQTMDLKVLVGGPLPFAYDILTTVFDYGNRVFVKYPXDIXXYFKQSFPEGFSWQRSMAYEDGGICLATNDITLNGDCFLYEIRFDGVNFPXNXPVMQKKTVKWEPSTEKXYVRDGVLKGDVNMALLLEGGGHYRCDFKTTYISKKVVQLPDYHFVDHRIEIESHDKDYNNVKLYEHAEAHSGLPRQAK
GenBank: ACV52377
UniProtKB: D1KWT4
IPG: 18466449

Excerpts

No excerpts have been added for sympFP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Novel Internal Regions of Fluorescent Proteins Undergo Divergent Evolutionary Patterns

Gruber Df, Desalle R, Lienau Ek, Tchernov D, Pieribone Va, Kao H-T

(2009). Molecular Biology and Evolution, 26(12) , 2841-2848. doi: 10.1093/molbev/msp194. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change