compare

Comparison List

stylGFP

stylGFP is a basic (constitutively fluorescent) green fluorescent protein published in 2008, derived from Stylocoeniella sp. NOA-2005.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Tetramer Stylocoeniella sp. NOA-2005 25.0 kDa -

FPbase ID: FWVH2

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
485 500 86,700 0.7 60.69      

Photostability

No photostability measurements available ... add one!

stylGFP Sequence

MALTKQCIANEMTMTFHMDGCVNGHYFTIEGEGSGRPYEGKQMSKFKVTKGGPLPFSFDILSSAFKYGNRCFTAYPAGMHDYFKQAFPEGMSYERTFTFEDGGVATASGDISLKGNCFVHKSMFHGVNFPADGPVMKKKTTGWDPSFEKMTVCNGILKGDVTMFLMLEDGKNYKCQFHTSYKTKKPVTLPSNHVVEHRIVRTNLDKAGNHVQLDEHAVAHVNPL
GenBank: ABB17963
UniProtKB: A8CLT7
IPG: 4901524

Excerpts

No excerpts have been added for stylGFP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change