compare

Comparison List

stylCP

stylCP is a fluorescent protein published in 2008, derived from Stylocoeniella sp. NOA-2005. It is reported to be a tetramer.

No spectrum has been submitted ... add a spectrum!

Aggregation Organism Molecular Weight Cofactor
Tetramer Stylocoeniella sp. NOA-2005 25.0 kDa -

Attributes

This protein does not yet have any fluorescent states assigned. Submit a change.

Photostability

no photostability measurements available ... add one!

stylCP Sequence

MSVIAKQMTYKVYMSGTVNGHYFEVQGDGKGKPYEGEQTVRLTVTKGGPLPFAWDILSPLSQYGSIPFTKYPEDIPDYVKQSFPEGYTWERIMNFEDGAVCTVSNDSSIQGNCFIYNVKISGLNFPPNGPVMQKKTQGWEPNTERLFARDGMLIGNNFMALKLEGGGHYLCEFKSTYKAKKPVRMPGYHYVDRKLDVTSHNRDYTSVEQCEISIARHSLLG
GenBank: ABB17951
UniProtKB: A8CLM7
IPG: 4901513

Excerpts

No excerpts have been added for stylCP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references yet...

External Resources

Something missing or incorrect? Submit a change Submit a change