compare

Comparison List

SOPP3

SOPP3 is a basic (constitutively fluorescent) cyan fluorescent protein published in 2017, derived from Arabidopsis thaliana. It requires the cofactor flavin for fluorescence.
+
SOPP3 Spectrum Fluorescent protein SOPP3 excitation and emission spectra
Oligomerization Organism Molecular Weight Cofactor
? Arabidopsis thaliana 12.1 kDa Flavin

FPbase ID: W4PW7

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
439 490 15,000 0.41 6.15      

Photostability

No photostability measurements available ... add one!

SOPP3 Sequence

MEKSFVITDPRLPDNPIIFASDGFLELTEYSREEILGRNGRFLQGPETDQATVQKIRDAIRDQREITVQLINYTKSGKKFLNLLNLQPIRDQKGELQAFIGVVLDG

Excerpts

No excerpts have been added for SOPP3
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

No Photon Wasted: An Efficient and Selective Singlet Oxygen Photosensitizing Protein

Westberg M, Bregnhøj M, Etzerodt M, Ogilby Pr

(2017). The Journal of Physical Chemistry B, 121(40) , 9366-9371. doi: 10.1021/acs.jpcb.7b07831. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change