compare

Comparison List

SOPP2

SOPP2 is a basic (constitutively fluorescent) cyan fluorescent protein published in 2017, derived from Arabidopsis thaliana. It requires the cofactor flavin for fluorescence.

No spectrum has been submitted ... add a spectrum!

Aggregation Organism Molecular Weight Cofactor
? Arabidopsis thaliana 12.2 kDa Flavin

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
439 491 14,800 0.41 6.07      

Photostability

no photostability measurements available ... add one!

SOPP2 Sequence

MEKSFVITDPRLPDNPIIFASDGFLELTEYSREEILGRNGRFLQGPETDQATVQKIRDAIRDQREITVQLINYTKSGKKFLNLLHLQPMRDQKGELQYFIGVVLDG

Excerpts

No excerpts have been added for SOPP2
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

No Photon Wasted: An Efficient and Selective Singlet Oxygen Photosensitizing Protein

Westberg M, Bregnhøj M, Etzerodt M, Ogilby Pr

(2017). The Journal of Physical Chemistry B, 121(40) , 9366-9371. doi: 10.1021/acs.jpcb.7b07831. Article   Pubmed

Additional References

    No additional references yet...

External Resources

Something missing or incorrect? Submit a change Submit a change