compare

Comparison List

shBFP-N158S/L173I

shBFP-N158S/L173I is a basic (constitutively fluorescent) uv fluorescent protein published in 2016, derived from Stichodactyla haddoni.
+
Oligomerization Organism Molecular Weight Cofactor
Monomer Stichodactyla haddoni 25.5 kDa -

FPbase ID: 4LKQ5

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
375 458 24,100 0.84 20.24      
Edit States/Attributes

Photostability

No photostability measurements available ... add one!

shBFP-N158S/L173I Sequence

BLAST

shBFP-N158S/L173I was derived from shBFP with the following mutations: N158S/L173I

MAGLLKESMRIKMDMEGTVNGHYFKCEGEGDGNPFTGTQSMRIHVTEGAPLPFAFDILAPCCLLGSRTFIHHTAGIPDFFKQSFPEGFTWERTTTYEDGGILTAHQDTSLEGNCLIYKVKVLGTNFPADGPVMKNKSEGWEPCTEVVYPDNGVLCGRSVMALKVGDRRLICHIYSSYKSKKAIRALTMPGFHFTDIRLQMPRKKKDEYFELYEASVARYSDLPEKAN

Excerpts

No excerpts have been added for shBFP-N158S/L173I
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Blue fluorescent protein derived from the mutated purple chromoprotein isolated from the sea anemone Stichodactyla haddoni

Chiang C-Y, Lin C-Y, Chen Y-T, Tsai H-J

(2016). Protein Engineering Design and Selection, 29(11) , 523-530. doi: 10.1093/protein/gzw041. Article   Pubmed

Additional References

  1. Crystal structure of the blue fluorescent protein with a Leu-Leu-Gly tri-peptide chromophore derived from the purple chromoprotein of Stichodactyla haddoni

    Chang H-Y, Ko T-P, Chang Y-C, Huang K-F, Lin C-Y, Chou H-Y, Chiang C-Y, Tsai H-J

    (2019). International Journal of Biological Macromolecules, 130, 675-684. doi: 10.1016/j.ijbiomac.2019.02.138. Article

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change