compare

Comparison List

sgBP-Q62M

sgBP-Q62M is a basic (constitutively fluorescent) fluorescent protein published in 2015, derived from Stichodactyla gigantea.
+
sgBP-Q62M Spectrum Fluorescent protein sgBP-Q62M excitation and emission spectra
Oligomerization Organism Molecular Weight Cofactor
? Stichodactyla gigantea 26.0 kDa -

FPbase ID: F2H19

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
608   122,923          

Photostability

No photostability measurements available ... add one!

sgBP-Q62M Sequence

sgBP-Q62M was derived from sgBP with the following mutations: Q62M

MVAIPENVRIKAFMEGAINNHHFKCEAEGEGKPYEGTQLERIRVTEGGPLPFSFDILSPHFMYGSVAITKYLSGIPDYFKQSFPEGFSWERTTMYEDGGYVTAHQDTSLDGNCLVYKIKVIGSNLPANGPVMQNKTRGWEPCTEMRYVRGGVLCGQSLMALKCADGNHLTCQLRTTYRSKKPAKKLQMPAFHFSDHRPEILKVSENGNLMEQYEMSVGRYCESVPSKLGHN

Excerpts

No excerpts have been added for sgBP-Q62M
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change