compare

Comparison List

sg50

sg50 is a basic (constitutively fluorescent) blue fluorescent protein published in 1997, derived from Aequorea victoria.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
? Aequorea victoria 26.9 kDa -

FPbase ID: 2VONA

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
384 450 16,500 0.25 4.12      

Photostability

No photostability measurements available ... add one!

sg50 Sequence

sg50 was derived from Q80R with the following mutations: M1_S2insA/F64L/Y66H/V163A

MASKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLSHGVQCFSRYPDHMKRHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK

Structure

Deposited: ,
Chromophore (SHG):

Excerpts

No excerpts have been added for sg50
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

The structural basis for spectral variations in green fluorescent protein

Palm Gj, Zdanov A, Gaitanaris Ga, Stauber R, Pavlakis Gn, Wlodawer A

(1997). Nature Structural & Molecular Biology, 4(5) , 361-365. doi: 10.1038/nsb0597-361. Article

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change