compare

Comparison List

sg42

sg42 is a basic (constitutively fluorescent) blue fluorescent protein published in 1997, derived from Aequorea victoria.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
? Aequorea victoria 26.9 kDa -

FPbase ID: RFW2X

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
384 450 15,600 0.24 3.74      
Edit States/Attributes

Photostability

No photostability measurements available ... add one!

sg42 Sequence

BLAST

sg42 was derived from Q80R with the following mutations: M1_S2insA/F64L/Y66H

MASKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLSHGVQCFSRYPDHMKRHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK

Structure

Deposited: ,
Chromophore (SHG):

Excerpts

No excerpts have been added for sg42
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

The structural basis for spectral variations in green fluorescent protein

Palm Gj, Zdanov A, Gaitanaris Ga, Stauber R, Pavlakis Gn, Wlodawer A

(1997). Nature Structural & Molecular Biology, 4(5) , 361-365. doi: 10.1038/nsb0597-361. Article

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change