compare

Comparison List

sg25

sg25 is a basic (constitutively fluorescent) green fluorescent protein published in 1997, derived from Aequorea victoria.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
? Aequorea victoria 26.9 kDa -

FPbase ID: 7ZG25

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
474 506 26,200 0.76 19.91      
Edit States/Attributes

Photostability

No photostability measurements available ... add one!

sg25 Sequence

BLAST

sg25 was derived from Q80R with the following mutations: M1_S2insA/F64L/S65C/I167T/K238N

MASKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLCYGVQCFSRYPDHMKRHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKTRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYN

Structure

Deposited: ,
Chromophore (CYG):

Excerpts

No excerpts have been added for sg25
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

The structural basis for spectral variations in green fluorescent protein

Palm Gj, Zdanov A, Gaitanaris Ga, Stauber R, Pavlakis Gn, Wlodawer A

(1997). Nature Structural & Molecular Biology, 4(5) , 361-365. doi: 10.1038/nsb0597-361. Article

Additional References

  1. Site-Specific Fragmentation of Green Fluorescent Protein Induced by Blue Light

    Heckmeier Pj, Langosch D

    (2021). Biochemistry, 60(32) , 2457-2462. doi: 10.1021/acs.biochem.1c00248. Article   Pubmed

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change