compare

Comparison List

sg12

sg12 is a basic (constitutively fluorescent) long stokes shift fluorescent protein published in 1997, derived from Aequorea victoria.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
? Aequorea victoria 27.0 kDa -

FPbase ID: T972V

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
396 508 18,300 0.85 15.55      

Photostability

No photostability measurements available ... add one!

sg12 Sequence

sg12 was derived from Q80R with the following mutations: M1_S2insA/F64L

MASKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLSYGVQCFSRYPDHMKRHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK

Structure

Deposited: ,
Chromophore (SYG):

Excerpts

No excerpts have been added for sg12
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

The structural basis for spectral variations in green fluorescent protein

Palm Gj, Zdanov A, Gaitanaris Ga, Stauber R, Pavlakis Gn, Wlodawer A

(1997). Nature Structural & Molecular Biology, 4(5) , 361-365. doi: 10.1038/nsb0597-361. Article

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change