compare

Comparison List

scubRFP

scubRFP is a basic (constitutively fluorescent) red fluorescent protein published in 2008, derived from Scolymia cubensis.

No spectrum has been submitted ... add a spectrum!

Aggregation Organism Molecular Weight Cofactor
Tetramer Scolymia cubensis 26.1 kDa -

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
570 578 66,400 0.6 39.84      

Photostability

no photostability measurements available ... add one!

scubRFP Sequence

MSAIKTVVKQFMKIKMSLEGTVNGHYFKIVGEGDGTPFEGKQTLHLKVKEGAPLPFAYDILTTALHYGNRVFVEYPENIPDYFKQSFPKGYSWERSLTFEDGGICIARSDIKMVGDTFHNEVQFYGVNFPANGPVMQRHTVKWEPSTEKIYVRDGVLTGDITMALLLKGGTHYRCDFRTTYKAKEKGPKFPGYHLVDHCIEITSHDKDYNVVELYEHAVAHSGLPDSANR
GenBank: AAU06843
UniProtKB: Q66PW1
IPG: 3620751

Excerpts

No excerpts have been added for scubRFP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references yet...

External Resources

Something missing or incorrect? Submit a change Submit a change