compare

Comparison List

scleFP1

scleFP1 is a fluorescent protein published in 2009, derived from Scleractinia sp. Lizard Island 38.

No spectrum has been submitted ... but a protein must have at least one state first. Add a state.

Oligomerization Organism Molecular Weight Cofactor
? Scleractinia sp. Lizard Island 38 16.7 kDa -

FPbase ID: C6XGJ

Attributes

This protein does not yet have any fluorescent states assigned. Submit a change.

Photostability

No photostability measurements available ... add one!

scleFP1 Sequence

MSVIKPDMKMKLRMEGAVNGHKFVIAGEGRGQPFEGKQTMDLTVKEGGPLPFAFDILTTVFDYGNRVFVKYPRDIADYFKQSFPEGFSWERSMAYEDGGICIATNNITLMKGDCFLYEIRFDGVNFPANSPVMQKRTVKWEPSTEKL
GenBank: ACV52385
UniProtKB: D1KWU2
IPG: 18466457

Excerpts

No excerpts have been added for scleFP1
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Novel Internal Regions of Fluorescent Proteins Undergo Divergent Evolutionary Patterns

Gruber Df, Desalle R, Lienau Ek, Tchernov D, Pieribone Va, Kao H-T

(2009). Molecular Biology and Evolution, 26(12) , 2841-2848. doi: 10.1093/molbev/msp194. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change