compare

Comparison List

SBFP2

SBFP2 is a basic (constitutively fluorescent) blue fluorescent protein published in 2007, derived from Aequorea victoria. It has moderate acid sensitivity.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Monomer Aequorea victoria 26.8 kDa -

FPbase ID: J325F

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
380 446 34,000 0.47 15.98 5.5    

Photostability

t1/2 (s) Power Light Mode In Cell Fusion ˚C Reference
2.1   Kremers et al. (2007)

SBFP2 Sequence

SBFP2 was derived from SBFP1 with the following mutations: L68V
amino acid numbers relative to avGFP. show relative to SBFP1

MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLSHGVQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNFNSHNVYITADKQKNGIKANFKIRHNIEDGGVQLADHYQQNTPIGDGPVLLPDNHYLSTQSKLSKDPNEKRDHMVLLEFVTAAGITLGMDELYK
GenBank: ABM97857
IPG: 6755367

Excerpts

No excerpts have been added for SBFP2
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change