compare

Comparison List

sarcGFP

sarcGFP is a basic (constitutively fluorescent) green fluorescent protein published in 2008, derived from Sarcophyton sp. NA-2008.

No spectrum has been submitted ... add a spectrum!

Aggregation Organism Molecular Weight Cofactor
Tetramer Sarcophyton sp. NA-2008 25.8 kDa -

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
483 500 76,700 0.96 73.63      

Photostability

no photostability measurements available ... add one!

sarcGFP Sequence

MSVIKQEMKIKLHMDGNVNGHAFVIEGDGKGKPYDGTQTLNLSVKEGAPLPFSYDILTNAFQYGNRAFTKYPADIPDYFKQTFPEGYSWERTMSYEDNAICNVRSEISMEGDCFIYKIRFDGKNFPPNGPVMQKKTLKWEPSTEMMYARDGFLMGDVNMALLLEGGGHHRCDFKTSYKAAKKNVQLPDYHYVDHRIEILSHDRDYNKVKLYENAVARYSLLPSQA
GenBank: ACD13195
UniProtKB: B6CTZ6
IPG: 14926076

Excerpts

No excerpts have been added for sarcGFP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references yet...

External Resources

Something missing or incorrect? Submit a change Submit a change