compare

Comparison List

Sapphire

a.k.a. H9-40

Sapphire is a basic (constitutively fluorescent) long stokes shift fluorescent protein published in 1998, derived from Aequorea victoria. It is reported to be a rapidly-maturing weak dimer with low acid sensitivity.
+
Sapphire Spectrum Fluorescent protein Sapphire excitation and emission spectra
Oligomerization Organism Molecular Weight Cofactor
Weak dimer Aequorea victoria 26.8 kDa -

FPbase ID: G4VP2

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
399 511 29,000 0.64 18.56 4.9 38.4  

Photostability

No photostability measurements available ... add one!

Sapphire Sequence

Sapphire was derived from avGFP with the following mutations: S72A/Y145F/T203I/H231L

MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNFNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSIQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK

Excerpts

No excerpts have been added for Sapphire
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change