compare

Comparison List

SAASoti

SAASoti is a photoconvertible green/yellow fluorescent protein published in 2015, derived from Stylocoeniella armata.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Tetramer Stylocoeniella armata 25.2 kDa -

FPbase ID: O72EP

Attributes

State Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
Red 510 589          
Green 510 519          
Edit state transitions

Photostability

No photostability measurements available ... add one!

SAASoti Sequence

MALSKQYIPDDMELIFHMDGCVNGHYFTIVATGKAKPYEGKQNLKATVTKGAPLPFSTDILSTVMHYGNRCIVHYPPGILDYFKQSFPEGYSWERTFAFEDGGFCTASADIKLKDNCFIHTSMFHGVNFPADGPVMQRKTIQWEKSIEKMTVSDGIVKGDITMFLLLEGGGKYRCQFHTSYKAKKVVEMPQSHYVEHSIERTNDDGTQFELNEHAVARLNEI

Excerpts

No excerpts have been added for SAASoti
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Fluorescence color diversity of great barrier reef corals

Lapshin G, Salih A, Kolosov P, Golovkina M, Zavorotnyi Y, Ivashina T, Vinokurov L, Bagratashvili V, Savitsky A

(2015). Journal of Innovative Optical Health Sciences, 08(04) , 1550028. doi: 10.1142/s1793545815500285. Article

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change