compare

Comparison List

Javascript is disabled! Many pages and features of FPbase will not work properly

SAASoti

This protein has unmoderated changes.

SAASoti is a photoconvertible green/yellow fluorescent protein published in 2015, derived from Stylocoeniella armata.

No spectrum has been submitted ... add a spectrum!

Oligomerization	Organism	Molecular Weight	Cofactor
Tetramer	Stylocoeniella armata	25.2 kDa	-

FPbase ID: O72EP

Attributes

State	Ex λ	Em λ	EC (M^-1 cm^-1)	QY	Brightness	pKa	Maturation (min)	Lifetime (ns)
Green	510	519
Red	510	589

Edit States/Attributes

Edit state transitions

Photostability

No photostability measurements available ... add one!

SAASoti Sequence

BLAST

MALSKQYIPDDMELIFHMDGCVNGHYFTIVATGKAKPYEGKQNLKATVTKGAPLPFSTDILSTVMHYGNRCIVHYPPGILDYFKQSFPEGYSWERTFAFEDGGFCTASADIKLKDNCFIHTSMFHGVNFPADGPVMQRKTIQWEKSIEKMTVSDGIVKGDITMFLLLEGGGKYRCQFHTSYKAKKVVEMPQSHYVEHSIERTNDDGTQFELNEHAVARLNEI

Excerpts

No excerpts have been added for SAASoti
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Fluorescence color diversity of great barrier reef corals

Lapshin G, Salih A, Kolosov P, Golovkina M, Zavorotnyi Y, Ivashina T, Vinokurov L, Bagratashvili V, Savitsky A

(2015). Journal of Innovative Optical Health Sciences, 08(04) , 1550028. doi: 10.1142/s1793545815500285. Article

Additional References

No additional references have been added.

External Resources

Search Addgene for SAASoti
Search RIKEN BRC for SAASoti

Change history

Something missing or incorrect? Submit a change Submit a change