compare

Comparison List

RSGFP3

RSGFP3 is a fluorescent protein published in 1995, derived from Aequorea victoria.

No spectrum has been submitted ... but a protein must have at least one state first. Add a state.

Oligomerization Organism Molecular Weight Cofactor
? Aequorea victoria 26.8 kDa -

FPbase ID: O1Z8P

Attributes

This protein does not yet have any fluorescent states assigned. Submit a change.

Photostability

No photostability measurements available ... add one!

RSGFP3 Sequence

RSGFP3 was derived from avGFP with the following mutations: F64G/S65C/V68M/Q69N

MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTGCYGMNCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK

Excerpts

No excerpts have been added for RSGFP3
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Red-Shifted Excitation Mutants of the Green Fluorescent Protein

Delagrave S, Hawtin Re, Silva Cm, Yang Mm, Youvan Dc

(1995). Nature Biotechnology, 13(2) , 151-154. doi: 10.1038/nbt0295-151. Article

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change