compare

Comparison List

rsCherryRev1.4

rsCherryRev1.4 is a photoswitchable red fluorescent protein published in 2014, derived from Discosoma sp..
+
Oligomerization Organism Molecular Weight Cofactor
Dimer Discosoma sp. 26.7 kDa -

FPbase ID: 1GO7S

Attributes

State Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
Off         5.5    
On 572 609          

Transitions

From To Switch λ
Off On 430
On Off 570

Photostability

No photostability measurements available ... add one!

rsCherryRev1.4 Sequence

rsCherryRev1.4 was derived from rsCherryRev with the following mutations: G24C/R36H/R125C/V144F/R149Q/E160L
amino acid numbers relative to DsRed. show relative to rsCherryRev

MVSKGEEDNMAIIKEFMRFKVHMEGSVNCHEFEIEGEGEGHPYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLCGTNFPSDGPVMQKKTMGWFACSEQMYPEDGALKGLSKMRLKLKDGGHYDAEFKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYK

Excerpts

The previously developed RSFP rsCherryRev has high photostability, high on–off contrast and low switching fatigue, but at the same time low overall folding efficiency, rendering it less suitable for demanding imaging applications such as RESOLFT nanoscopy. Therefore, we decided to further improve the properties of rsCherryRev to make it suitable for RESOLFT.

Lavoie-Cardinal et al. (2014)

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change