compare

Comparison List

rrGFP

a.k.a. rrenGFP, rGFP, hrGFP

rrGFP is a fluorescent protein published in 2007, derived from Renilla reniformis.

No spectrum has been submitted ... but a protein must have at least one state first. Add a state.

Oligomerization Organism Molecular Weight Cofactor
? Renilla reniformis 26.2 kDa -

FPbase ID: 84CGO

Attributes

This protein does not yet have any fluorescent states assigned. Submit a change.

Photostability

No photostability measurements available ... add one!

rrGFP Sequence

MDLAKLGLKEVMPTKINLEGLVGDHAFSMEGVGEGNILEGTQEVKISVTKGAPLPFAFDIVSVAFGYGNRAYTGYPEEISDYFLQSFPEGFTYERNIRYQDGGTAIVKSDISLEDGKFIVNVDFKAKDLRRMGPVMQQDIVGMQPSYESMYTNVTSVIGECIIAFKLQTGKHFTYHMRTVYKSKKPVETMPLYHFIQHRLVKTNVDTASGYVVQHETAIAAHSTIKKIEGSLPVD

Structure

Deposited: ,
Chromophore (GYG):

Excerpts

No excerpts have been added for rrGFP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Crystal Structures of the Luciferase and Green Fluorescent Protein from Renilla reniformis

Loening Am, Fenn Td, Gambhir Ss

(2007). Journal of Molecular Biology, 374(4) , 1017-1028. doi: 10.1016/j.jmb.2007.09.078. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change