compare

Comparison List

RFP637

RFP637 is a basic (constitutively fluorescent) red fluorescent protein published in 2008, derived from Entacmaea quadricolor.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Tetramer Entacmaea quadricolor 26.1 kDa -

FPbase ID: QVF1F

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
587 637 72,000 0.23 16.56   480.0  
Edit States/Attributes

Photostability

t1/2 (s) Power Light Mode In Cell Fusion ˚C Reference
60.0   Kredel et al. (2008)
A caution on interpretation of photostability measurements
Add photostability info

RFP637 Sequence

BLAST

RFP637 was derived from RFP618 with the following mutations: S158A

MNSLIKENMRMMVVMEGSVNGYQFKCTGEGDGNPYMGTQTMRIKVVEGGPLPFAFDILATSFMYGSKTFIKHTKGIPDFFKQSFPEGFTWERVTRYEDGGVFTVMQDTSLEDGCLVYHAKVTGVNFPSNGAVMQKKTKGWEPSTEMLYPADGGLRGYAQMALNVDGGGYLFCSFETTYRSKKTDENFKMPGFHFVDHRLERLEESDKEMFVVQHEHAVAKFCDLPSKLGRL

Excerpts

No excerpts have been added for RFP637
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Optimized and Far-Red-Emitting Variants of Fluorescent Protein eqFP611

Kredel S, Nienhaus K, Oswald F, Wolff M, Ivanchenko S, Cymer F, Jeromin A, Michel Fj, Spindler K-D, Heilker R, Nienhaus Gu, Wiedenmann J

(2008). Chemistry & Biology, 15(3) , 224-233. doi: 10.1016/j.chembiol.2008.02.008. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change