compare

Comparison List

rfloRFP

rfloRFP is a basic (constitutively fluorescent) red fluorescent protein published in 2002, derived from Ricordea florida.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
? Ricordea florida kDa -

FPbase ID: 46ZQ7

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
566 574          

Photostability

No photostability measurements available ... add one!

rfloRFP Sequence

MSALKEEMKIXLTLVGVVNGHPFKIIGDGKGKPYEGSQELTLAVVEGGPLPFSYDILTTIVHYGNRAFVNYPKDIPDIFKQTCSGPGAGYSWQRTMSFEDGGVCTATSHIRVDGDTFNYDIHFMGADFPLNGPVMQKRTVKWEPSTEIMFQCDGLLRGDVAMSLLLKGGGHYRCDFKTIYKPKKNVKMPGYHFVDHCIEITSQQDDYNVVELYEGAVAHYSPLQKPCQAKA
GenBank: AAK71339
UniProtKB: Q8T5E8
IPG: 1324312

Excerpts

No excerpts have been added for rfloRFP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Diversity and evolution of the green fluorescent protein family

Labas Ya, Gurskaya Ng, Yanushevich Yg, Fradkov Af, Lukyanov Ka, Lukyanov Sa, Matz Mv

(2002). Proceedings of the National Academy of Sciences, 99(7) , 4256-4261. doi: 10.1073/pnas.062552299. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change