compare

Comparison List

rfloGFP

rfloGFP is a basic (constitutively fluorescent) green/yellow fluorescent protein published in 2002, derived from Ricordea florida.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
? Ricordea florida 26.0 kDa -

FPbase ID: OM1OY

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
508 518          

Photostability

No photostability measurements available ... add one!

rfloGFP Sequence

MSALKEEMKIKLKMVGVVNGQSFQIDGEGKGKPYEGSQKLTLEVVEGGPLLFSYDILTTIFQYGNRAFVNYPKDIPDIFKQTCSGPDGGFSWQRTMTYEDGGVCTASNHISVDGDTFYYVIRFNGENFPPNGPVMQKRTVKWEPSTEIMFERDGLLRGDIAMSLLLKGGGHYRCDFKTIYTPKRKVNMPGYHFVDHCIEIQKHDKDYNMAVLSEDAVAHNSPLEKKSQAKA
GenBank: AAK71338
UniProtKB: Q8T5E9
IPG: 110579

Excerpts

No excerpts have been added for rfloGFP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Diversity and evolution of the green fluorescent protein family

Labas Ya, Gurskaya Ng, Yanushevich Yg, Fradkov Af, Lukyanov Ka, Lukyanov Sa, Matz Mv

(2002). Proceedings of the National Academy of Sciences, 99(7) , 4256-4261. doi: 10.1073/pnas.062552299. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change