compare

Comparison List

psupFP

psupFP is a fluorescent protein published in 2009, derived from Psammocora superficialis.

No spectrum has been submitted ... add a spectrum!

Aggregation Organism Molecular Weight Cofactor
? Psammocora superficialis kDa -

Attributes

This protein does not yet have any fluorescent states assigned. Submit a change.

Photostability

no photostability measurements available ... add one!

psupFP Sequence

MSVIAKQMTYKVYMSGTVNGHYFEVEGDGKGKPYEGEQTVXLTVTKGGPLPFXWDILSPQTQYGSIPFTKYPEDIPDYVKQSFPEGYTWERIMNFEDGAVCTVSNDSSIQGNCFIYNVKISGLNFPPNGPVMQKKTQGWEPNTERLFARDGMLIGNNFMALKLEGGGHYLCEFKSTYKAKKPVRMPGYHYVDRKLDVTSHBKDYTXVEQCEISIARHSLLG
GenBank: ACV52379
UniProtKB: D1KWT6
IPG: 18466451

Excerpts

No excerpts have been added for psupFP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Novel Internal Regions of Fluorescent Proteins Undergo Divergent Evolutionary Patterns

Gruber Df, Desalle R, Lienau Ek, Tchernov D, Pieribone Va, Kao H-T

(2009). Molecular Biology and Evolution, 26(12) , 2841-2848. doi: 10.1093/molbev/msp194. Article   Pubmed

Additional References

    No additional references yet...

External Resources

Something missing or incorrect? Submit a change Submit a change