compare

Comparison List

psamCFP

psamCFP is a basic (constitutively fluorescent) blue fluorescent protein published in 2008, derived from Psammocora sp. NA-2008.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Tetramer Psammocora sp. NA-2008 25.9 kDa -

FPbase ID: U69HK

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
404 492 30,800 0.96 29.57      

Photostability

No photostability measurements available ... add one!

psamCFP Sequence

MASTKNVLPNMMTLTYHMEGSVNGHNFEIIGEGTGNPKEGKHTITLQVVKGGPLPFSVDILSTVFQYGNRCFTKYPPNTVDYFKNSCPPGYTFERSFLYEDGAVCTASGDITLSDDKASFHHKSKFFGVNFPDDGPVMKKKTTDWEPSCEKMTPSGKTLKGDVIEFLLLEGGGRYKCQFHTVYRAKTEPKRMPEFHFVQHKLTRTDVSDPLKQQWQLTEDAAACESCFHK
GenBank: ACD13191
UniProtKB: B6CTZ2
IPG: 14926072

Excerpts

No excerpts have been added for psamCFP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change