compare

Comparison List

Pp2 FbFP

a.k.a. FMN-binding fluorescent protein

Pp2 FbFP is a basic (constitutively fluorescent) cyan fluorescent protein published in 2014, derived from Pseudomonas putida. It requires the cofactor flavin for fluorescence.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Dimer Pseudomonas putida 17.0 kDa Flavin

FPbase ID: 4BUSQ

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
449 495 14,200 0.22 3.12      

Photostability

No photostability measurements available ... add one!

Pp2 FbFP Sequence

MINAKLLQLMVEHSNDGIVVAEQEGNESILIYVNPAFERLTGYCADDILYQDARFLQGEDHDQPGIAIIREAIREGRPCCQVLRNYRKDGSLFWNELSITPVHNEADQLTYYIGIQRDVTAQVFAEERVRELEAEVAELRRQQGQAKH
GenBank: SKB92435.1
UniProtKB: Q88JB0
IPG: AEV23113.1

Excerpts

No excerpts have been added for Pp2 FbFP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change