compare

Comparison List

pmimGFP2

pmimGFP2 is a basic (constitutively fluorescent) green fluorescent protein published in 2010, derived from Pontella mimocerami. It has low acid sensitivity.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Tetramer Pontella mimocerami 25.1 kDa -

FPbase ID: U97V7

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
491 505 79,000 0.92 72.68 4.7    

Photostability

No photostability measurements available ... add one!

pmimGFP2 Sequence

MPNMKLECRISGTMNGEEFKLVGAGEGNTDEGRMTNKVKSTKGPLPFSPYLLSHVLGYGYYHYATFPAGYENVYLHAMKNGGYSNTRTERYEDGGIISATFNYRYEGDKIIGDFKVVGTGFPTNSIIFTDKIIKSNPTCEHIYPKADNILVNAYTRTWMLRDGGYYSAQVNNHMHFKSAIHPTMLQNGGSMFTYRKVEELHTQTEVGIVEYQHVFKRPTAFA
GenBank: ACT99047
UniProtKB: D2IGW1
IPG: 18218401

Excerpts

No excerpts have been added for pmimGFP2
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change