compare

Comparison List

pHuji

pHuji is a basic (constitutively fluorescent) red fluorescent protein published in 2014, derived from Discosoma sp.. It has high acid sensitivity.
+
Oligomerization Organism Molecular Weight Cofactor
Monomer Discosoma sp. 27.0 kDa -

FPbase ID: SS15T

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
566 598 31,000 0.22 6.82 7.7    

Photostability

No photostability measurements available ... add one!

pHuji Sequence

MVSKGEENNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEAFQTAKLKVTKGGPLPFAWDILSPQFMYGSKVYIKHPADIPDYFKLSFPEGFRWERVMNFEDGGIIHVNQDSSLQDGVFIYKVKLRGTNFPSDGPVMQKKTMGWEASEERMYPEDGALYSEIKKRLKLKDGGHYAAEVKTTYKAKKPVQLPGAYIVDIKLDIVSHNEDYTIVEQYERAEGRHSTGGMDELYK

Excerpts

No excerpts have been added for pHuji
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

pHuji, a pH-sensitive red fluorescent protein for imaging of exo- and endocytosis

Shen Y, Rosendale M, Campbell Re, Perrais D

(2014). The Journal of Cell Biology, 207(3) , 419-432. doi: 10.1083/jcb.201404107. Article   Pubmed

Additional References

  1. Survey of Red Fluorescence Proteins as Markers for Secretory Granule Exocytosis

    Gandasi Nr, Vestö K, Helou M, Yin P, Saras J, Barg S

    (2015). PLOS ONE, 10(6) , e0127801. doi: 10.1371/journal.pone.0127801. Article   Pubmed

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change