compare

Comparison List

pHluorin2

pHluorin2 is a multistate long stokes shift fluorescent protein published in 2011, derived from Aequorea victoria.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
? Aequorea victoria 26.9 kDa -

FPbase ID: SJT6S

Attributes

State Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
acidic 475 509          
alkaline 395 509          
Edit state transitions

Photostability

No photostability measurements available ... add one!

pHluorin2 Sequence

pHluorin2 was derived from pHluorin, ratiometric with the following mutations: F64L

MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKDDGNILGHKLEYNYNEHLVYIMADKQKNGIKVIFQVHHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLHTQSALSKDPNEKRDHMVFLEFVTAAGITHGMDELYK

Excerpts

Using GFP2 as a template, an enhanced ratiometric pHluorin (pHluorin2) construct was developed to contain fully mammalianized codons, the F64L mutation and ten of the thirteen pHluorin-specific mutations. As a result, pHluorin2 displays markedly higher flores-cence when compared to pHluorin while maintaining the ratiometric pH-sensitivity.

Mahon (2011)

Analogous to the development of the superecliptic pHluorin, inclusion of mammalianized codons and the F64L mutation in the ratiometric pHluorin backbone markedly enhances florescence while maintaining the desired pH-sensitivity, yielding a super-ratiometric variant called pHluorin2.

Mahon (2011)

Primary Reference

pHluorin2: an enhanced, ratiometric, pH-sensitive green florescent protein

Mahon Mj

(2011). Advances in Bioscience and Biotechnology, 02(03) , 132-137. doi: 10.4236/abb.2011.23021. Article   Pubmed

Additional References

  1. Fluorescence Lifetime Imaging of pH along the Secretory Pathway

    Linders Pta, Ioannidis M, Ter Beest M, Van Den Bogaart G

    (2022). ACS Chemical Biology, 17(1) , 240-251. doi: 10.1021/acschembio.1c00907. Article   Pubmed

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change