compare

Comparison List

pHluorin2

pHluorin2 is a multistate long stokes shift fluorescent protein published in 2011, derived from Aequorea victoria.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
? Aequorea victoria 26.9 kDa -

FPbase ID: SJT6S

Attributes

State Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
alkaline 395 509          
acidic 475 509          
Edit state transitions

Photostability

No photostability measurements available ... add one!

pHluorin2 Sequence

pHluorin2 was derived from pHluorin, ratiometric with the following mutations: F64L

MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKDDGNILGHKLEYNYNEHLVYIMADKQKNGIKVIFQVHHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLHTQSALSKDPNEKRDHMVFLEFVTAAGITHGMDELYK

Excerpts

No excerpts have been added for pHluorin2
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

pHluorin2: an enhanced, ratiometric, pH-sensitive green florescent protein

Mahon Mj

(2011). Advances in Bioscience and Biotechnology, 02(03) , 132-137. doi: 10.4236/abb.2011.23021. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change