compare

Comparison List

Javascript is disabled! Many pages and features of FPbase will not work properly

pHluorin2

pHluorin2 is a multistate long stokes shift fluorescent protein published in 2011, derived from Aequorea victoria.

No spectrum has been submitted ... add a spectrum!

Oligomerization	Organism	Molecular Weight	Cofactor
?	Aequorea victoria	26.9 kDa	-

FPbase ID: SJT6S

Attributes

State	Ex λ	Em λ	EC (M^-1 cm^-1)	QY	Brightness	pKa	Maturation (min)	Lifetime (ns)
acidic	475	509
alkaline	395	509

Edit States/Attributes

Edit state transitions

Photostability

No photostability measurements available ... add one!

pHluorin2 Sequence

BLAST

pHluorin2 was derived from pHluorin, ratiometric with the following mutations: F64LF64L

MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKDDGNILGHKLEYNYNEHLVYIMADKQKNGIKVIFQVHHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLHTQSALSKDPNEKRDHMVFLEFVTAAGITHGMDELYK

Excerpts

No excerpts have been added for pHluorin2
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

pHluorin2: an enhanced, ratiometric, pH-sensitive green florescent protein

Mahon Mj

(2011). Advances in Bioscience and Biotechnology, 02(03) , 132-137. doi: 10.4236/abb.2011.23021. Article Pubmed

Additional References

No additional references have been added.

External Resources

Search Addgene for pHluorin2
Search RIKEN BRC for pHluorin2

Change history

Something missing or incorrect? Submit a change Submit a change