compare

Comparison List

phiLOV2.1

phiLOV2.1 is a basic (constitutively fluorescent) cyan fluorescent protein published in 2021, derived from Arabidopsis thaliana. It has very low acid sensitivity.
+
phiLOV2.1 Spectrum Fluorescent protein phiLOV2.1 excitation and emission spectra
Oligomerization Organism Molecular Weight Cofactor
Monomer Arabidopsis thaliana 12.7 kDa -

FPbase ID: T33XW

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
451 501 13,500 0.2 2.7 3.0    

Photostability

No photostability measurements available ... add one!

phiLOV2.1 Sequence

MEKSFVITDPRLPDYPIIFASDGFLELTEYSREEIMGRNARFLQGPETDQATVQKIRDAIRDQRETTVQLINYTKSGKKFWNLLHLQPVRDRKGGLQYFIGVQLVGSDHV

Excerpts

No excerpts have been added for phiLOV2.1
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change