compare

Comparison List

pFAST

pFAST is a small protein tag engineered to have a highly rigid structure, with a well-defined chromophore-binding pocket with enhanced binding promiscuity. Binding to a compatible fluorogenic chromophore is required for fluorescence.

No spectrum has been submitted ... but a protein must have at least one state first. Add a state.

Oligomerization Organism Molecular Weight Cofactor
Monomer Halorhodospira halophila 13.9 kDa -

FPbase ID: L9VOW

Attributes

This protein does not yet have any fluorescent states assigned. Submit a change.

Photostability

No photostability measurements available ... add one!

pFAST Sequence

BLAST
MEHVAFGSEDIENTLANMDDEQLDRLAFGVIQLDGDGNILLYNAAEGDITGRDPKQVIGKNFFKDVAPGTDTPEFYGKFKEGAASGNLNTMFEWTIPTSRGPTKVKVHLKKALSGDRYWVFVKRV

Excerpts

pFAST is a chemogenetic reporter. For information regarding spectras with different ligands, please search within the data base pFAST + Ligand

Benaissa et al. (2021)

pFAST is a chemogenetic reporter. For information regarding spectras with different ligands, please search within the data base pFAST + Ligand

Benaissa et al. (2021)

Primary Reference

Engineering of a fluorescent chemogenetic reporter with tunable color for advanced live-cell imaging

Benaissa H, Ounoughi K, Aujard I, Fischer E, Goïame R, Nguyen J, Tebo Ag, Li C, Le Saux T, Bertolin G, Tramier M, Danglot L, Pietrancosta N, Morin X, Jullien L, Gautier A

(2021). Nature Communications, 12(1) , 6989. doi: 10.1038/s41467-021-27334-0. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change