compare

Comparison List

PdaC1

PdaC1 is a basic (constitutively fluorescent) green fluorescent protein published in 2004, derived from Pocillopora damicornis.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
? Pocillopora damicornis 25.1 kDa -

FPbase ID: 8HBTK

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
480 492          

Photostability

No photostability measurements available ... add one!

PdaC1 Sequence

MSLSKQVILKDMNLKFEMKGSVNGHYFEIEGEGRGKPYEGVQKSTFWVTKGGPLPFSFDILSSAFKYGNRCFTKYPADMPDYFKEAFPAGMSFERTFTFEDGGVATASGHICLEGNWFKHTSMFHGVNFPANGPIMQKRTIGWDPSFEKMTVSNNILRGDVTMFLQLKGGGYHSCQFHTSYKTKEPVTLPQNHVVEHRITRTDIEDKKVLLEETAVAHVNPL
GenBank: AAU04450
UniProtKB: Q66ND1
IPG: 4912128

Excerpts

No excerpts have been added for PdaC1
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Cloning of anthozoan fluorescent protein genes

Carter Rw, Schmale Mc, Gibbs Pdl

(2004). Comparative Biochemistry and Physiology Part C: Toxicology & Pharmacology, 138(3) , 259-270. doi: 10.1016/j.cca.2004.07.002. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change