Change History for pcDronpa2
-
2018-12-12 21:02, user: talley
- changed protein pcDronpa2 aliases: None->[]
- added protein pcDronpa2 parent_organism_id: 301887
- changed protein pcDronpa2 pdb: None->[]
- added protein pcDronpa2 seq: MSVIKPDMKIKLRMEGAVNGHPFAIEGVGLGKPFEGKQSMDLKVKEGGPLPFAYDILTTAFHYGNRVFAKYPENIVDYFKQSFPEGYSWERSMSYEDGGICIATNDITLDGDCYINEIRFDGVNFPANGPVMQKRTVKWEPSTEKLYVRDGVLKGDVNMALSLEGGGHYRCDFKTTYKAKKVVQLPDYHFVDHHIEIKSHDKDYSNVNLHEHAEAHSGLPRQAK
- added lineage pcDronpa2
-
2018-12-12 21:03, user: talley
- added excerpt Moeyaert et al. (2014): The red form of pcDronpa2 has ...
-
2018-12-12 21:04, user: talley
- changed excerpt Moeyaert et al. (2014): The red form of pcDronpa2 has ... content: Rational mutagenesis based on literature examples (S142A, V157I/G/S, M159A/T, F173S/L)15,23,45,48 did not generate a four-way highlighter pcDronpa2 mutant (data not shown).->The red form of pcDronpa2 has the highest extinction coefficient of all PCFP red forms known to date and is, just like its ancestor pcDronpa, not photoswitchable in the red form. Rational mutagenesis based on literature examples (S142A, V157I/G/S, M159A/T, F173S/L)15,23,45,48 did not generate a four-way highlighter pcDronpa2 mutant (data not shown).
-
2018-12-12 21:04, user: talley
- changed State pcDronpa2 (Green) name: Green->Green (On)
- changed State pcDronpa2 (Green) slug: pcdronpa2_green->pcdronpa2_green-on
- changed protein pcDronpa2 switch_type: pc->pa
- added State pcDronpa2 (Green (Off))
-
2018-12-12 21:08, user: talley
- added excerpt Moeyaert et al. (2014): We found that reverting the N1...
-
2018-12-12 21:08, user: talley
- changed excerpt Moeyaert et al. (2014): We found that reverting the N1... content: We found that reverting the N102I and E218G mutations is not a viable strategy to obtain a monomeric pcDronpa2 variant... As an alternative approach, we used our crystallographic data to rationally break the tetramer interfaces in a different way. Mutations N158E and Y188A disrupted the A/C interface, while V123T additionally broke the A/B interface. Although we could thus successfully make a monomeric version of pcDronpa2 (pcDronpa2-V123TN158E-Y188A), this mutant displayed no photoconversion.->We found that reverting the N102I and E218G mutations is not a viable strategy to obtain a monomeric pcDronpa2 variant... As an alternative approach, we used our crystallographic data to rationally break the tetramer interfaces in a different way. Mutations N158E and Y188A disrupted the A/C interface, while V123T additionally broke the A/B interface. Although we could thus successfully make a monomeric version of pcDronpa2 (pcDronpa2-V123T-N158E-Y188A), this mutant displayed no photoconversion.
-
2018-12-12 21:10, user: talley
- changed protein pcDronpa2 switch_type: pa->ps
- added state transition Transition: pcDronpa2 Green -> Green (Off)
-
2018-12-12 21:10, user: talley
- added state transition Transition: pcDronpa2 Green (Off) -> Green
-
2019-01-22 13:02, user: kadmon
- changed State pcDronpa2 (Green) name: Green (On)->Green
- changed State pcDronpa2 (Green) slug: pcdronpa2_green-on->pcdronpa2_green
- changed protein pcDronpa2 switch_type: ps->mp
- changed lineage pcDronpa2 lft: 11->13
- changed lineage pcDronpa2 rght: 12->14
- changed lineage pcDronpa2 tree_id: 20->23
- removed excerpt Moeyaert et al. (2014): The red form of pcDronpa2 has ...
- removed excerpt Moeyaert et al. (2014): We found that reverting the N1...
-
2019-02-03 20:44, user: talley
Back to current pcDronpa2 version