compare

Comparison List

P4-3E

P4-3E is a basic (constitutively fluorescent) blue fluorescent protein published in 1998, derived from Aequorea victoria.
+
P4-3E Spectrum Fluorescent protein P4-3E excitation and emission spectra
Oligomerization Organism Molecular Weight Cofactor
? Aequorea victoria 26.7 kDa -

FPbase ID: LKB4E

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
384 448 22,000 0.27 5.94      

Photostability

No photostability measurements available ... add one!

P4-3E Sequence

ASKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLSHGVQCFSRYPDHMKRHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNFNSHNVYIMADKQKNGIKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK

Excerpts

No excerpts have been added for P4-3E
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change