compare

Comparison List

OFP

OFP is a basic (constitutively fluorescent) orange fluorescent protein published in 2007, derived from Ceriantharia.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Tetramer Ceriantharia 25.1 kDa -

FPbase ID: KETFB

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
548 573 60,000 0.64 38.4      

Photostability

No photostability measurements available ... add one!

OFP Sequence

MNLSKNVSVSVYMKGNVNNHEFEYDGEGGGDPYTGKYSMKMTLRGQNCLPFSYDIITTAFQYGFRVFTKYPEGIVDYFKDSLPDAFQWNRRIVFEDGGVLNMSSDITYKDNVLHGDVWAVGVNFPPNGPVMKNEIVMEEPTEETFTPKNGVLVGFCPKAYLLKDGSYYYGNMTTFYRSKKSGQAPPGYHFVKHRLVKTNVGHGFKTVEQTEYATAHVSDLPK
GenBank: AAP55761
UniProtKB: Q7Z168
IPG: 1658661

Excerpts

No excerpts have been added for OFP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Something missing or incorrect? Submit a change Submit a change