compare

Comparison List

obeYFP

obeYFP is a basic (constitutively fluorescent) green/yellow fluorescent protein published in 2011, derived from Obelia sp..

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
? Obelia sp. 26.4 kDa -

FPbase ID: WRGL6

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
514 528 77,000 0.57 43.89      

Photostability

No photostability measurements available ... add one!

obeYFP Sequence

MSSAGALLFTNKIPYVTELEGDVNGMKFTIHGKGTGDASTGHIEAKYVCTSGEIPVPWATLVSTMCYGVQCFAKYPSHIKDFYKSAMPEGYIQERTISFEGDGVYKTRAMVTYERGSIYNRVTLTGENFKKDGHILRKNVAFQCPPSILYILPDTVNNGIRVEFNQVFDIEGETEKLVSSFSQINRPLAESAAVHIPRYHHITYHTKLSKDRDERRDHMCLVEVVKAVDLDTYQ
GenBank: AEL17651
UniProtKB: G1JSF4
IPG: 24262674

Excerpts

No excerpts have been added for obeYFP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Multi-colored homologs of the green fluorescent protein from hydromedusa Obelia sp.

Aglyamova Gv, Hunt Me, Modi Ck, Matz Mv

(2011). Photochemical & Photobiological Sciences, 10(8) , 1303. doi: 10.1039/c1pp05068k. Article

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change