compare

Comparison List

obeGFP

obeGFP is a basic (constitutively fluorescent) green fluorescent protein published in 2011, derived from Obelia sp..

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
? Obelia sp. 26.4 kDa -

FPbase ID: 782GK

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
502 515 78,000 0.62 48.36      

Photostability

No photostability measurements available ... add one!

obeGFP Sequence

MSSAGALLFTNKIPYVTELEGDVNGMKFTIHGKGTGDASTGHIEAKYVCTSGEIPVPWATLVSTMCYGVQCFAKYPSHIKDFYKSAMPEGYIQERTISFEGDGVYKTRAMVTYERGSIYNRVTLTGENFKKDGHILRKNVAFQCLPSILYILPDTVNNGIRVEFNQVYDIEGEIEKLVTKCSQMNRPLAESAAVHIPRYHHISKHTKLSKDLDERRDHMCLVEVVKAVDLDTYQ
GenBank: AEL17650
UniProtKB: G1JSF3
IPG: 24262673

Excerpts

No excerpts have been added for obeGFP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Multi-colored homologs of the green fluorescent protein from hydromedusa Obelia sp.

Aglyamova Gv, Hunt Me, Modi Ck, Matz Mv

(2011). Photochemical & Photobiological Sciences, 10(8) , 1303. doi: 10.1039/c1pp05068k. Article

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change