compare

Comparison List

obeCFP

obeCFP is a basic (constitutively fluorescent) long stokes shift fluorescent protein published in 2011, derived from Obelia sp..

No spectrum has been submitted ... add a spectrum!

Aggregation Organism Molecular Weight Cofactor
? Obelia sp. 26.2 kDa -

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
400 499 36,000 0.62 22.32      

Photostability

no photostability measurements available ... add one!

obeCFP Sequence

MSSAGALLFTNKIPYVTELEGDVNGMKFTIHGKGTGDASTGNIEAKYVCTSGEIPVPWATLVSTLSYGVQCFAKYPSHIKDFFKSAMPEGYTQERTISFEGDGVYKTRAMVTYERGSIYNRVTLTGENFKKDGHILRKNVAFQCPPDMVYILPDTVNNGIRVEFNQAYDIEGVTEKLVTKCSQMNRPLAGSAAVHIPRYHHLSKHTKLSKDRDERRDHMCLVEVVKAVDLDTYQ
GenBank: AEL17649
UniProtKB: G1JSF2
IPG: 24262672

Excerpts

No excerpts have been added for obeCFP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Multi-colored homologs of the green fluorescent protein from hydromedusa Obelia sp.

Aglyamova Gv, Hunt Me, Modi Ck, Matz Mv

(2011). Photochemical & Photobiological Sciences, 10(8) , 1303. doi: 10.1039/c1pp05068k. Article

Additional References

    No additional references yet...

External Resources

Something missing or incorrect? Submit a change Submit a change