compare

Comparison List

nanoLuc

a.k.a. nLuc; nanoluciferase

nanoLuc is a basic (constitutively fluorescent) cyan fluorescent protein published in 2012, derived from Oplophorus gracilirostris.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
? Oplophorus gracilirostris 19.1 kDa -

FPbase ID: M8P3S

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
460 460          
Edit States/Attributes

Photostability

No photostability measurements available ... add one!

nanoLuc Sequence

BLAST
MVFTLEDFVGDWRQTAGYNLDQVLEQGGVSSLFQNLGVSVTPIQRIVLSGENGLKIDIHVIIPYEGLSGDQMGQIEKIFKVVYPVDDHHFKVILHYGTLVIDGVTPNMIDYFGRPYEGIAVFDGKKITVTGTLWNGNKIIDERLINPDGSLLFRVTINGVTGWRLCERILA

Excerpts

No excerpts have been added for nanoLuc
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Engineered Luciferase Reporter from a Deep Sea Shrimp Utilizing a Novel Imidazopyrazinone Substrate

Hall Mp, Unch J, Binkowski Bf, Valley Mp, Butler Bl, Wood Mg, Otto P, Zimmerman K, Vidugiris G, Machleidt T, Robers Mb, Benink Ha, Eggers Ct, Slater Mr, Meisenheimer Pl, Klaubert Dh, Fan F, Encell Lp, Wood Kv

(2012). ACS Chemical Biology, 7(11) , 1848-1857. doi: 10.1021/cb3002478. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change