compare

Comparison List

nanoLuc

a.k.a. nLuc; nanoluciferase

nanoLuc is a basic (constitutively fluorescent) cyan fluorescent protein published in 2012, derived from Oplophorus gracilirostris.
+
nanoLuc Spectrum Fluorescent protein nanoLuc excitation and emission spectra
Oligomerization Organism Molecular Weight Cofactor
? Oplophorus gracilirostris 19.1 kDa -

FPbase ID: M8P3S

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
460 460          

Photostability

No photostability measurements available ... add one!

nanoLuc Sequence

MVFTLEDFVGDWRQTAGYNLDQVLEQGGVSSLFQNLGVSVTPIQRIVLSGENGLKIDIHVIIPYEGLSGDQMGQIEKIFKVVYPVDDHHFKVILHYGTLVIDGVTPNMIDYFGRPYEGIAVFDGKKITVTGTLWNGNKIIDERLINPDGSLLFRVTINGVTGWRLCERILA

Excerpts

No excerpts have been added for nanoLuc
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change